Holo-[acyl-carrier-protein] Synthase, Recombinant, Acholeplasma laidlawii, aa1-118, His-Tag, Myc-Tag
Referência 584877-100ug
Tamanho : 100ug
Marca : US Biological
584877 Rabbit Anti-Holo-[acyl-carrier-protein] Synthase, Recombinant, Acholeplasma laidlawii, aa1-118, His-Tag, Myc-Tag
Clone Type
PolyclonalSwiss Prot
A9NHV3Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CTransfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.||Source:|Recombinant protein corresponding to aa1-118 from Acholeplasma laidlawii Holo-[acyl-carrier-protein] synthase, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli.||Molecular Weight: |~20.9kD||Amino Acid Sequence:|MIHAIGTDLVELERIKSIGIDRFKDKILNEDEKNEYAKINHENRKLTYLAGRFAVKESLFKCFKAGDKTANYKDFSVLNDSVGAPYVVSKHTSDFVVHITISHTNLYAIAFVVLETKV||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.