PUS7 Antibody - N-terminal region
Referência ARP46289_T100-25UL
Tamanho : 25ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
PUS7 Antibody - N-terminal region (ARP46289_T100)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-PUS7 (ARP46289_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PUS7 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 75%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISH |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-PUS7 (ARP46289_T100) antibody is Catalog # AAP46289 (Previous Catalog # AAPS17712) |
| Reference | Hillier,L.W., (2003) Nature 424 (6945), 157-164 |
|---|---|
| Gene Symbol | PUS7 |
| Gene Full Name | Pseudouridylate synthase 7 homolog (S. cerevisiae) |
| Alias Symbols | IDDABS |
| NCBI Gene Id | 54517 |
| Protein Name | Pseudouridylate synthase 7 homolog |
| Description of Target | The function remains unknown. |
| Uniprot ID | Q96PZ0 |
| Protein Accession # | NP_061915 |
| Nucleotide Accession # | NM_019042 |
| Protein Size (# AA) | 661 |
| Molecular Weight | 75kDa |
| Protein Interactions | UBC; IDE; DPYSL2; HSPA4L; HSPH1; STAT3; SIRT1; WDR74; ELAVL1; SUMO2; |