Recombinant Human Interferon a-6/IFNA6 (C-6His)

Referência 32-7569-50

Tamanho : 50ug

Marca : Abeomics

Solicitar mais informações

Contactar o distribuidor local :


Telefone : +1 850 650 7790

Recombinant Human Interferon a-6/IFNA6 (C-6His)



Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKEVDHHHHHH
Gene : IFNA6
Gene ID : 3443
Uniprot ID : P05013
Source: Human Cells.
MW :21.1kD.
Recombinant Human Interferon alpha-6 is produced by our Mammalian expression system and the target gene encoding Ser21-Glu189 is expressed with a 6His tag at the C-terminus. Interferon a-6 (IFN-a6) is a secreted protein which belongs to the a/ beta interferon family. IFN-a6 is produced by macrophages, expressed at low level, only 1.0% of the average gene in this release. IFN-a6 contains interferon alpha, beta and delta domain. IFN-a has antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
BioGrid: 109666. 4 interactions.
There are currently no product reviews