Reagentes e instrumentos para imunologia, biologia celular e biologia molecular.
 
> TYMS monoclonal antibody (M01), clone 3A1

TYMS monoclonal antibody (M01), clone 3A1

Imprimir Imprimir
Please log in

Referência H00007298-M01

Tamanho : 100ug

Marca : Abnova

Solicitar mais informações

Contactar o distribuidor local :


Telefone : +1 850 650 7790

  • Specifications

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant TYMS.MAB,monoclonal Ab,monoclonal antibody

    Immunogen

    TYMS (AAH13919, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    ANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC

    Host

    Mouse

    Reactivity

    Human

    Isotype

    IgG1 Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (36.52 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    TYMS monoclonal antibody (M01), clone 3A1 Western Blot analysis of TYMS expression in HeLa ( Cat # L013V1 ).
    Protocol Download

    Western Blot (Transfected lysate)

    Western Blot analysis of TYMS expression in transfected 293T cell line by TYMS monoclonal antibody (M01), clone 3A1.

    Lane 1: TYMS transfected lysate(35.7 KDa).
    Lane 2: Non-transfected lysate.
    Protocol Download

    Western Blot (Recombinant protein)

    Protocol Download

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunoperoxidase of monoclonal antibody to TYMS on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
    Protocol Download

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged TYMS is approximately 0.03ng/ml as a capture antibody.
    Protocol Download

    ELISA

    Immunofluorescence

    Immunofluorescence of monoclonal antibody to TYMS on HeLa cell. [antibody concentration 20 ug/ml]
    Protocol Download
  • Gene Info class="font-18 semiblod">Entrez GeneID 7298

    GeneBank Accession#

    BC013919

    Protein Accession#

    AAH13919

    Gene Name

    TYMS

    Gene Alias

    HsT422, MGC88736, TMS, TS, TSase

    Gene Description

    thymidylate synthetase

    Omim ID

    188350

    Gene Ontology

    Hyperlink

    Gene Summary

    Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occuring antisense transcript rTSalpha (GeneID:55556) vary inversely when cell-growth progresses from late-log to plateau phase. [provided by RefSeq

    Other Designations

    Thymidylate synthase

  • Interactomes
  • Pathways
  • Diseases

    + View More Disease

    - View Less Disease

    • Você também pode estar interessado nos seguintes produtos:



    Referência
    Descrição
    Cond.
    Price Bef. VAT