ZNF474 antibody - N-terminal region
Referência ARP32163_P050
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
ZNF474 Antibody - N-terminal region (ARP32163_P050)
| Datasheets/Manuals | Printable datasheet for anti-ZNF474 (ARP32163_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF474 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 91%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 86%; Pig: 92%; Rat: 83% |
| Peptide Sequence | Synthetic peptide located within the following region: SDSYSSLSPETESVNPGENIKTDTQKKRPGTVILSKLSSRRIISESQLSP |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ZNF474 (ARP32163_P050) antibody is Catalog # AAP32163 (Previous Catalog # AAPP03135) |
| Reference | Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004) |
|---|---|
| Gene Symbol | ZNF474 |
| Gene Full Name | Zinc finger protein 474 |
| Alias Symbols | FLJ32921 |
| NCBI Gene Id | 133923 |
| Protein Name | Zinc finger protein 474 |
| Description of Target | The specific function of ZNF474 is not yet known. |
| Uniprot ID | Q6S9Z5 |
| Protein Accession # | NP_997200 |
| Nucleotide Accession # | NM_207317 |
| Protein Size (# AA) | 364 |
| Molecular Weight | 40kDa |
| Protein Interactions | UBC; |
