Tpit (TBX19) Rabbit Polyclonal Antibody
Cat# TA330269
Size : 100ul
Tpit (TBX19) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Application | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TBX19 antibody: synthetic peptide directed towards the middle region of human TBX19. Synthetic peptide located within the following region: IKYNPFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCT |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 48 kDa |
Gene Name | T-box 19 |
Database Link | |
Background | TBX19 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx19/Tpit gene. Studies in mouse show that Tpit protein is present only in the two pituitary pro-opiomelanocortin (POMC)-expressing lineages, the corticotrophs and melanotrophs. Mutations in the human ortholog were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage.This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage. ACTH deficiency is characterized by adrenal insufficiency symptoms such as weight loss, lack of appetite (anorexia), weakness, nausea, vomiting, and low blood pressure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | dJ747L4.1; TBS19; TPIT |
Note | Immunogen sequence homology: Human: 100%; Pig: 93%; Mouse: 93%; Rabbit: 93%; Horse: 85%; Dog: 79%; Bovine: 79%; Guinea pig: 79%; Rat: 77% |
Reference Data |
Write Your Own Review
Product Manuals |
FAQs |
|
SDS |
Antibody Resources |
|
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.