CD9 antibody - N-terminal region
Cat# ARP61171_P050
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
CD9 Antibody - N-terminal region (ARP61171_P050)
| Datasheets/Manuals | Printable datasheet for anti-CD9 (ARP61171_P050) antibody |
|---|
| Publications | Isolation and Characterization of Small Extracellular Vesicles from Porcine Blood Plasma, Cerebrospinal Fluid, and Seminal Plasma. Proteomes. 7, (2019). 31027284 |
|---|---|
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CD9 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 92%; Goat: 93%; Guinea Pig: 77%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93%; Rabbit: 86%; Rat: 100%; Sheep: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: KYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-CD9 (ARP61171_P050) antibody is Catalog # AAP61171 (Previous Catalog # AAPP47322) |
| Gene Symbol | CD9 |
|---|---|
| Gene Full Name | CD9 molecule |
| Alias Symbols | MIC3, MRP-1, BTCC-1, DRAP-27, TSPAN29, TSPAN-29 |
| NCBI Gene Id | 928 |
| Protein Name | CD9 antigen |
| Description of Target | This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. |
| Uniprot ID | P21926 |
| Protein Accession # | NP_001760 |
| Nucleotide Accession # | NM_001769 |
| Protein Size (# AA) | 228 |
| Molecular Weight | 25 kDa |
| Protein Interactions | ADRB2; UBC; VKORC1; CLN8; ATP6V1B1; LGALS3BP; ELAVL1; IGSF8; CD81; ITGA3; TSPAN4; ADAM2; PTGFRN; SERPINH1; ITGA2; PRKCA; CD36; KIT; CD63; CD53; ITGB1; ITGA5; HBEGF; CD59; CD38; CD19; CD46; CD82; |
