CREB3L1 antibody - N-terminal region

Cat# ARP36109_T100

Size : 100ul

Brand : Aviva Systems Biology

Request more information

Contact local distributor :


Phone : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-CREB3L1 (ARP36109_T100) antibody
Product Info
Publications

CREB3L1-mediated functional and structural adaptation of the secretory pathway in hormone-stimulated thyroid cells. J Cell Sci. 130, 4155-4167 (2017). 29093023

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CREB3L1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: FTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSG
Concentration1.0 mg/ml
Blocking PeptideFor anti-CREB3L1 (ARP36109_T100) antibody is Catalog # AAP36109 (Previous Catalog # AAPP07437)
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceOmori,Y., et al., (2002) Biochem. Biophys. Res. Commun. 293 (1), 470-477
Gene SymbolCREB3L1
Gene Full NameCAMP responsive element binding protein 3-like 1
Alias SymbolsOI16, OASIS
NCBI Gene Id90993
Protein NameCyclic AMP-responsive element-binding protein 3-like protein 1
Description of TargetThe CREB3L1 gene encodes a protein with a transmembrane domain that is a transcriptional activator of the CREB/ATF family.
Uniprot IDQ96CP0
Protein Accession #NP_443086
Nucleotide Accession #NM_052854
Protein Size (# AA)519
Molecular Weight57kDa
Protein InteractionsTMEM218; SLC30A8; MFSD5; SLC35B4; JAGN1; TMEM234; FXYD6; NRM; PGRMC1; FAM3C; TMEM147; PRKAB2; GPR25; RUNX1T1; C5; TSPO; Fbxw7; UBE2D3; UBA1; CREB3L1; CREB3L3; CREB3; DDIT3; CREM;
  1. What is the species homology for "CREB3L1 Antibody - N-terminal region (ARP36109_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "CREB3L1 Antibody - N-terminal region (ARP36109_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CREB3L1 Antibody - N-terminal region (ARP36109_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CREB3L1 Antibody - N-terminal region (ARP36109_T100)"?

    This target may also be called "OI16, OASIS" in publications.

  5. What is the shipping cost for "CREB3L1 Antibody - N-terminal region (ARP36109_T100)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "CREB3L1 Antibody - N-terminal region (ARP36109_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CREB3L1 Antibody - N-terminal region (ARP36109_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CREB3L1 Antibody - N-terminal region (ARP36109_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CREB3L1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CREB3L1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CREB3L1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CREB3L1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CREB3L1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CREB3L1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT
04-0012-02
 2mg(10mM) 
NP892-011
 350μg:175μg×2tube/box 
72390-01
 50Pack