Kera Antibody - C-terminal region

Cat# ARP52276_P050-25UL

Size : 25ul

Brand : Aviva Systems Biology

Contact local distributor :


Phone : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-Kera (ARP52276_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Goat: 80%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: MQLNMAKNALRNMPPRLPANTMQLFLDNNSIEGIPENYFNVIPKVAFLRL
Concentration0.5 mg/ml
Blocking PeptideFor anti-Kera (ARP52276_P050) antibody is Catalog # AAP52276
Enhanced Validation
SPR Affinity Characterization Avivasheild
Gene SymbolKera
Gene Full NameKeratocan
Alias SymbolsCN, SL, KTN, CNA2, SLRR2B
NCBI Gene Id16545
Protein NameKeratocan
Description of TargetKera may be important in developing and maintaining corneal transparency and for the structure of the stromal matrix.
Uniprot IDO35367
Protein Accession #NP_032464
Nucleotide Accession #NM_008438
Protein Size (# AA)351
Molecular Weight39 kDa
  1. What is the species homology for "Kera antibody - C-terminal region (ARP52276_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "Kera antibody - C-terminal region (ARP52276_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Kera antibody - C-terminal region (ARP52276_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Kera antibody - C-terminal region (ARP52276_P050)"?

    This target may also be called "CN, SL, KTN, CNA2, SLRR2B" in publications.

  5. What is the shipping cost for "Kera antibody - C-terminal region (ARP52276_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "Kera antibody - C-terminal region (ARP52276_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Kera antibody - C-terminal region (ARP52276_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Kera antibody - C-terminal region (ARP52276_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "KERA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KERA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KERA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KERA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KERA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KERA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT
TY003
 20mlBottle