SMT3 Recombinant Protein
Cat# OPCA02235-20UG
Size : 20ug
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
| Datasheets/Manuals | Printable datasheet for SMT3 Recombinant Protein (Baker's yeast) (OPCA02235) (OPCA02235) |
|---|
| Predicted Species Reactivity | Saccharomyces cerevisiae |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Yeast |
| Additional Information | Relevance: Not known; suppressor of MIF2 mutations. |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG |
| Protein Sequence | SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 2-98 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Ulp1-SUMO crystal structure and genetic analysis reveal conserved interactions and a regulatory element essential for cell growth in yeast.Mossessova E., Lima C.D.Mol. Cell 5:865-876(2000) |
|---|---|
| Gene Symbol | SMT3 |
| Gene Full Name | SUMO family protein SMT3 |
| Alias Symbols | SUMO family protein SMT3;YDR510W. |
| NCBI Gene Id | 852122 |
| Protein Name | Ubiquitin-like protein SMT3 |
| Description of Target | Not known; suppressor of MIF2 mutations. |
| Uniprot ID | Q12306 |
| Protein Accession # | NP_010798.1 |
| Nucleotide Accession # | NM_001180818.1 |
| Protein Size (# AA) | Recombinant |
| Molecular Weight | 27.1 kDa |