SOX21 Rabbit Polyclonal Antibody

CAT#: TA329317

Rabbit Polyclonal anti-SOX21 antibody


Product Images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SOX21 antibody: synthetic peptide directed towards the middle region of human SOX21. Synthetic peptide located within the following region: EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 28 kDa
Gene Name SRY-box 21
Background SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are divided into 6 subgroups based on sequence similarity within and outside of the HMG domain. For additional background information on SOX genes, see SOX1 (MIM 602148). [supplied by OMIM, Apr 2004]
Synonyms SOX25
Note Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 86%
Reference Data

Documents