B2M Antibody - N-terminal region : FITC
Cat# ARP56555_P050-FITC
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
B2M Antibody - N-terminal region : FITC (ARP56555_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-B2M (ARP56555_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human B2M |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 79%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%; Sheep: 83% |
| Peptide Sequence | Synthetic peptide located within the following region: MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGF |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-B2M (ARP56555_P050-FITC) antibody is Catalog # AAP56555 (Previous Catalog # AAPP39214) |
| Reference | Platt,G.W., (2008) J. Mol. Biol. 378 (1), 251-263 |
|---|---|
| Gene Symbol | B2M |
| Gene Full Name | Beta-2-microglobulin |
| Alias Symbols | IMD43 |
| NCBI Gene Id | 567 |
| Protein Name | Beta-2-microglobulin |
| Description of Target | This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fib |
| Uniprot ID | P61769 |
| Protein Accession # | NP_004039 |
| Nucleotide Accession # | NM_004048 |
| Protein Size (# AA) | 119 |
| Molecular Weight | 12kDa |
| Protein Interactions | UBC; CRYAB; B2M; MAPK15; TAP2; HLA-A; HFE; HLA-B; TAPBP; TAP1; GRB2; LILRB1; PRSS23; FCGRT; CD1E; CD1D; CD1A; CD1B; CD8A; HLA-F; HLA-E; HLA-G; HLA-C; BAG6; CALR; A2M; |
