En1/Hu-En-1

Cat# P100923_P050

Size : 100ul

Brand : Aviva Systems Biology

Request more information

Contact local distributor :


Phone : +1 850 650 7790

Aviva Systems Biology will be closed on Friday, April 18th, in observance of Good Friday.

EN1 Antibody - C-terminal region (P100923_P050)

Datasheets/ManualsPrintable datasheet for anti-EN1 (P100923_P050) antibody
Product Info
Publications

Beltran, A. S., Graves, L. M. & Blancafort, P. Novel role of Engrailed 1 as a prosurvival transcription factor in basal-like breast cancer and engineering of interference peptides block its oncogenic function. Oncogene. doi:10.1038/onc.2013.422 (2013). 24141779

More...

Tested Species ReactivityHuman
Predicted Species ReactivityGuinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human EN1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 93%; Rabbit: 86%
Peptide SequenceSynthetic peptide located within the following region: LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK
Concentration0.5 mg/ml
Blocking PeptideFor anti-EN1 (P100923_P050) antibody is Catalog # AAP31276 (Previous Catalog # AAPP02025)
ReferenceAtit,R., (2006) Dev. Biol. 296 (1), 164-176
Gene SymbolEN1
Gene Full NameEngrailed homeobox 1
Alias SymbolsENDOVESLB
NCBI Gene Id2019
Protein NameHomeobox protein engrailed-1
Description of TargetHomeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ05925
Protein Accession #NP_001417
Nucleotide Accession #NM_001426
Protein Size (# AA)392
Molecular Weight40kDa
Protein InteractionsTLE1; PAX6; JUN;

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT