EOMES Rabbit Polyclonal Antibody
Cat# TA343539
Size : 100ul
Contact local distributor :
| Product Data | |
| Application | WB |
|---|---|
| Application | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-EOMES antibody: synthetic peptide directed towards the middle region of human EOMES. Synthetic peptide located within the following region: YTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGMGGYYAFYTT |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 73 kDa |
| Gene Name | eomesodermin |
| Database Link | |
| Background | EOMES is a member of a conserved protein family that shares a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. A similiar gene disrupted in mice is shown to be essential |
| Synonyms | TBR2 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Horse: 93%; Mouse: 93%; Guinea pig: 93% |
| Reference Data | |
Write Your Own Review
| Product Manuals |
| FAQs |
|
| SDS |
| Antibody Resources |
|
Related Products
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.