Fusion glycoprotein F0 Recombinant Protein
Cat# OPCA02979-100UG
Size : 100ug
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
F Recombinant Protein (Human respiratory syncytial virus B) (OPCA02979)
| Datasheets/Manuals | Printable datasheet for F Recombinant Protein (Human respiratory syncytial virus B) (OPCA02979) |
|---|
| Predicted Species Reactivity | Human Orthopneumovirus|Human respiratory syncytial virus B|Human Respiratory Syncytial Virus B |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Reconstitution and Storage | -20°C or -80°C |
| Peptide Sequence | FLGFLLGVGSAIASGIAVSKVLHLEGEVNKIKNALLSTNKAVVSLSNGVSVLTSKVLDLKNYINNQLLPIVNQQSCRISNIETVIEFQQKNSRLLEINREFSVNAGVTTPLSTYMLTNSELLSLINDMPITNDQKKLMSSNVQIVRQQSYSIMSIIKEEVLAYVVQLPIYGVIDTPCWKLHTSPLCTTNIKEGSNICLTRTDRGWYCDNAGSVSFFPQADTCKVQSNRVFCDTMNSLTLPSEVSLCNTDIFNSKYDCKIMTSKTDISSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKLEGKNLYVKGEPIINYYDPLVFPSDEFDASISQVNEKINQSLAFIRRSDELLHNVNTGKSTTNIMITTIIIVIIVVLLSLIAIGLLLYCKAKNTPVTLSKDQLSGINNIAFSK |
| Source | Yeast |
| Gene Symbol | F |
|---|---|
| Gene Full Name | fusion glycoprotein |
| Alias Symbols | fusion glycoprotein, HRSVgp08. |
| NCBI Gene Id | 1489825 |
| Protein Name | Fusion glycoprotein F0 |
| Description of Target | During virus entry, induces fusion of viral and cellular membranes leading to delivery of the nucleocapsid into the cytoplasm. The fusogenic activity is inactive untill entry into host cell endosome, where a furin-like protease cleaves off a small peptide between F1 and F2. Interacts directly with heparan sulfate and may participate in virus attachment. Furthermore, the F2 subunit was identifed as the major determinant of RSV host cell specificity. Later in infection, proteins F expressed at the plasma membrane of infected cells can mediate fusion with adjacent cells to form syncytia, a cytopathic effect that could lead to tissue necrosis. The fusion protein is also able to trigger p53-dependent apoptosis. |
| Uniprot ID | O36634 |
| Protein Size (# AA) | Partial |
| Molecular Weight | 50.1 kda |