MRCA Recombinant Protein (Escherichia coli)
Cat# OPCA04426-1MG
Size : 1mg
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
| Datasheets/Manuals | Printable datasheet for MRCA Recombinant Protein (Escherichia coli) (OPCA04426) (OPCA04426) |
|---|
| Predicted Species Reactivity | Escherichia coli |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Additional Information | Species Specificity Detail: Escherichia coli (strain K12) |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | Tris-base, 50% glycerol |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | MLDEGYITQQQFDQTRTEAINANYHAPEIAFSAPYLSEMVRQEMYNRYGESAYEDGYRIYTTITRKVQQAAQQAVRNNVLDYDMRHGYRGPANVLWKVGESAWDNNKITDTLKALPTYGPLLPAAVTSANPQQATAMLADGSTVALSMEGVRWARPYRSDTQQGPTPRKVTDVLQTGQQIWVRQVGDAWWLAQVPEVNSALVSINPQNGAVMALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGLTLASMLNDVPISRWDASAGSDWQPKNSPPQYAGPIRLRQGLGQSKNVVM |
| Protein Sequence | MLDEGYITQQQFDQTRTEAINANYHAPEIAFSAPYLSEMVRQEMYNRYGESAYEDGYRIYTTITRKVQQAAQQAVRNNVLDYDMRHGYRGPANVLWKVGESAWDNNKITDTLKALPTYGPLLPAAVTSANPQQATAMLADGSTVALSMEGVRWARPYRSDTQQGPTPRKVTDVLQTGQQIWVRQVGDAWWLAQVPEVNSALVSINPQNGAVMALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGLTLASMLNDVPISRWDASAGSDWQPKNSPPQYAGPIRLRQGLGQSKNVVM |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 229-529 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) . |
|---|---|
| Gene Symbol | mrcA |
| Gene Full Name | peptidoglycan glycosyltransferase/peptidoglycan DD-transpeptidase MrcA |
| Alias Symbols | b3396;ECK3383;peptidoglycan glycosyltransferase/peptidoglycan DD-transpeptidase MrcA;ponA. |
| NCBI Gene Id | 947907 |
| Protein Name | Penicillin-binding protein 1A |
| Description of Target | Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits). |
| Uniprot ID | P02918 |
| Protein Accession # | NP_417855 |
| Nucleotide Accession # | NC_000913 |
| Protein Size (# AA) | Recombinant |
| Molecular Weight | 49.5 kDa |