Recombinant Human Interferon a-6/IFNA6 (C-6His)
Recombinant Human Interferon a-6/IFNA6 (C-6His)
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKEVDHHHHHH |
Source: Human Cells.
MW :21.1kD.
Recombinant Human Interferon alpha-6 is produced by our Mammalian expression system and the target gene encoding Ser21-Glu189 is expressed with a 6His tag at the C-terminus. Interferon a-6 (IFN-a6) is a secreted protein which belongs to the a/ beta interferon family. IFN-a6 is produced by macrophages, expressed at low level, only 1.0% of the average gene in this release. IFN-a6 contains interferon alpha, beta and delta domain. IFN-a has antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
MW :21.1kD.
Recombinant Human Interferon alpha-6 is produced by our Mammalian expression system and the target gene encoding Ser21-Glu189 is expressed with a 6His tag at the C-terminus. Interferon a-6 (IFN-a6) is a secreted protein which belongs to the a/ beta interferon family. IFN-a6 is produced by macrophages, expressed at low level, only 1.0% of the average gene in this release. IFN-a6 contains interferon alpha, beta and delta domain. IFN-a has antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 109666. 4 interactions. |
| There are currently no product reviews |
