Recombinant Human Trifunctional Purine Biosynthetic Protein Adenosine-3, aa111-318, His-Tag

Print

Cat# 586134-20ug

Size : 20ug

Contact local distributor :

Phone : +1 850 650 7790

Brand : US Biological

Request more information

Contact local distributor :

Phone : +1 850 650 7790

586134 Recombinant Human Trifunctional Purine |Biosynthetic Protein Adenosine-3, aa111-318, His-Tag

Clone Type

Polyclonal

Swiss Prot

P22102

Grade

Purified

Shipping Temp

Blue Ice

Storage Temp

-20°C

Source:|Recombinant protein corresponding to aa111-318 from human Trifunctional purine biosynthetic protein adenosine-3, fused to 6X His-Tag at N-terminal, expressed in E.coli.||Molecular Weight: |~26.5kD||Amino Acid Sequence:|KEFMDRHGIPTAQWKAFTKPEEACSFILSADFPALVVKASGLAAGKGVIVAKSKEEACKAVQEIMQEKAFGAAGETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYCPAPQVSNDLLLKIKDTVLQRTVDGMQQEGTPYTGILYAGIMLTKNGPKVLEFNCRFGDPECQVILPLLKSDLYEVIQSTLD||Storage and Stability:|Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Applications

Source: Recombinant, E. coli|Purity: ≥85% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

Form

Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.

Purity

≥85% (SDS-PAGE)