Small EDRK rich factor 1 (SERF1A) (NM_022968) Human Recombinant Protein
Cat# TP324986
Size : 20ug
Contact local distributor :
Small EDRK rich factor 1 (SERF1A) (NM_022968) Human Recombinant Protein
SKU
TP324986
Recombinant protein of human small EDRK-rich factor 1A (telomeric) (SERF1A), transcript variant 2, 20 µg
- MVPro
Full-length human proteins expressed in HEK293T cells
In Stock*
| Product Data | |
| Species | Human |
|---|---|
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence | Protein Sequence >RC224986 representing NM_022968 Red=Cloning site Green=Tags(s) MARGNQRELARQKNMKKTQEISKGKRKEDSLTASQRKQRDSEIMQEKQKAANEKKSMQTREK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 7.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_075257 |
| Locus ID | 8293 |
| UniProt ID | O75920 |
| Cytogenetics | 5q13.2 |
| RefSeq ORF | 186 |
| Synonyms | 4F5; FAM2A; H4F5; SERF1; SMAM1 |
| Summary | This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. The duplication region includes both a telomeric and a centromeric copy of this gene. Deletions of this gene, the telomeric copy, often accompany deletions of the neighboring SMN1 gene in spinal muscular atrophy (SMA) patients, and so it is thought that this gene may be a modifier of the SMA phenotype. The function of this protein is not known; however, it bears low-level homology with the RNA-binding domain of matrin-cyclophilin, a protein which colocalizes with small nuclear ribonucleoproteins (snRNPs) and the SMN1 gene product. Alternatively spliced transcripts have been documented but it is unclear whether alternative splicing occurs for both the centromeric and telomeric copies of the gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Write Your Own Review
| FAQs |
|
| SDS |
Recombinant Protein Resources |
| SKU | Description | Size | ||
|---|---|---|---|---|
| PH324986 | SERF1A MS Standard C13 and N15-labeled recombinant protein (NP_075257) | 10 ug | | |
| LC411852 | SERF1A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug | | |
| LC429713 | SERF1A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug | | |
| LY411852 | Transient overexpression lysate of small EDRK-rich factor 1A (telomeric) (SERF1A), transcript variant 1 | 100 ug | | |
| LY429713 | Transient overexpression lysate of small EDRK-rich factor 1A (telomeric) (SERF1A), transcript variant 2 | 100 ug | | |
Related Products
Check items to add to the cart or
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.