ZNF474 antibody - N-terminal region
Cat# ARP32163_P050
Size : 100ul
Brand : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-ZNF474 (ARP32163_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF474 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 91%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 86%; Pig: 92%; Rat: 83% |
Peptide Sequence | Synthetic peptide located within the following region: SDSYSSLSPETESVNPGENIKTDTQKKRPGTVILSKLSSRRIISESQLSP |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-ZNF474 (ARP32163_P050) antibody is Catalog # AAP32163 (Previous Catalog # AAPP03135) |
Reference | Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004) |
---|---|
Gene Symbol | ZNF474 |
Gene Full Name | Zinc finger protein 474 |
Alias Symbols | FLJ32921 |
NCBI Gene Id | 133923 |
Protein Name | Zinc finger protein 474 |
Description of Target | The specific function of ZNF474 is not yet known. |
Uniprot ID | Q6S9Z5 |
Protein Accession # | NP_997200 |
Nucleotide Accession # | NM_207317 |
Protein Size (# AA) | 364 |
Molecular Weight | 40kDa |
Protein Interactions | UBC; |