Arl8b (NM_026011) Mouse Tagged ORF Clone

Referencia MR201737

embalaje : 10ug

Contact local distributor :


Teléfono :

Arl8b (NM_026011) Mouse Tagged ORF Clone

SKU
MR201737
Arl8b (Myc-DDK-tagged) - Mouse ADP-ribosylation factor-like 8B (Arl8b)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

Bulk Requests & Clone Modifications
Specifications
Product Data
Target Symbol Arl8b
Synonyms 2610313E07Rik; 3100002J04Rik; Arl10c; gie1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201737 representing NM_026011
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGCGCTCATCTCCCGCCTGCTGGACTGGTTCCGTTCGCTCTTCTGGAAGGAGGAGATGGAACTGA
CGCTCGTGGGGCTGCAGTACTCCGGCAAGACCACCTTCGTCAATGTCATCGCGTCCGGTCAATTCAGTGA
AGATATGATACCCACAGTGGGCTTCAACATGAGGAAAGTAACTAAAGGCAACGTCACAATAAAGATCTGG
GACATAGGCGGACAGCCCCGGTTCCGGAGCATGTGGGAGCGGTACTGCCGAGGAGTCAATGCAATTGTTT
ACATGATAGATGCTGCAGATCGAGAAAAGATAGAAGCCTCTCGAAATGAACTGCATAATCTTCTAGATAA
ACCACAGTTACAAGGGATTCCAGTACTAGTACTTGGAAACAAGAGAGATCTTCCAAATGCCTTGGATGAG
AAACAGCTAATTGAGAAAATGAACCTGTCTGCTATTCAGGATAGAGAAATTTGCTGCTATTCAATTTCTT
GCAAAGAAAAGGATAATATAGATATCACACTTCAGTGGCTTATTCAACACTCAAAATCCCGGAGAAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR201737 representing NM_026011
Red=Cloning site Green=Tags(s)

MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIW
DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDE
KQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_026011
ORF Size 558 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_026011.3, NP_080287.1
RefSeq Size 2928 bp
RefSeq ORF 561 bp
Locus ID 67166
UniProt ID Q9CQW2
Cytogenetics 6 E2
MW 22 kDa
Summary Plays a role in lysosome motility (PubMed:30174114). In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function (PubMed:30174114). May play a role in chromosome segregation (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Arl8b (NM_026011) Mouse Tagged ORF Clone
Your Rating
SKU Description Size
MC200962 Arl8b (untagged) - Mouse ADP-ribosylation factor-like 8B (Arl8b), (10ug) 10 ug
MG201737 Arl8b (tGFP-tagged) - Mouse ADP-ribosylation factor-like 8B (Arl8b) 10 ug
MR201737L3 Lenti ORF clone of Arl8b (Myc-DDK-tagged) - Mouse ADP-ribosylation factor-like 8B (Arl8b) 10 ug
MR201737L4 Lenti ORF clone of Arl8b (mGFP-tagged) - Mouse ADP-ribosylation factor-like 8B (Arl8b) 10 ug
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Products

  • cDNA Clones
  • Antibodies
  • Proteins
  • Vectors
  • RNAi
  • Gene Expression
  • Assay Kits
  • Tissues
  • Others

Product Support

  • Product FAQs
  • Product Manuals
  • SDS
  • Citations

Customer Support

  • Order Support
  • Technical Support
  • International Distributors
  • cDNA Clone Match
  • Product Review

Learning Resources

  • Video and Webinar
  • Brochures & Flyers
  • Protocols
  • Ebooks
  • Scientific Papers
  • Bioinformatics Tools

About Us

  • About Us
  • Press Releases
  • Conferences
  • Customer Testimonials
  • Careers
  • Legal Notices
  • Contact Us

Usted podría estar interesado también en los siguientes productos:



Referencia
Descripción
Cond.
Precio Sin IVA
A2585-10mg
 10mg