Arl8a (NM_026823) Mouse Tagged ORF Clone

Referencia MR201740

embalaje : 10ug

Contact local distributor :


Teléfono :

Arl8a (NM_026823) Mouse Tagged ORF Clone

Specifications
Product Data
Target Symbol Arl8a
Synonyms 1110033P22Rik; Arl10b; gie2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201740 representing NM_026823
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCGCTTTGTTCAACAAGCTGCTGGACTGGTTCAAGGCCCTGTTCTGGAAGGAGGAAATGGAGCTCA
CGCTGGTGGGGCTGCAGTACTCGGGCAAGACCACCTTCGTCAACGTGATCGCGTCAGGACAGTTCAATGA
GGACATGATCCCCACTGTGGGTTTCAACATGCGAAAAATCACCAAAGGGAATGTGACCATCAAGCTCTGG
GACATTGGGGGGCAGCCCCGTTTCCGAAGCATGTGGGAACGCTACTGCAGAGGAGTGAGCGCCATTGTGT
ATATGGTGGATGCTGCGGATCAGGAGAAGATCGAGGCCTCCAAGAATGAGCTCCACAACCTGCTAGACAA
GCCACAGCTACAAGGCATCCCGGTCTTAGTCCTTGGTAACAAGCGAGACCTCGCCGGAGCGCTAGATGAG
AAGGAGCTAATCGAGAAAATGAACCTGTCTGCTATCCAGGACCGAGAGATCTGCTGCTACTCCATATCCT
GCAAAGAGAAGGACAACATAGACATCACCCTACAGTGGCTTATTCAACACTCAAAGTCACGGAGAAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR201740 representing NM_026823
Red=Cloning site Green=Tags(s)

MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLW
DIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLAGALDE
KELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_026823
ORF Size 558 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_026823.2, NP_081099.1
RefSeq Size 1702 bp
RefSeq ORF 561 bp
Locus ID 68724
UniProt ID Q8VEH3
Cytogenetics 1 E4
MW 21.8 kDa
Summary Plays a role in lysosomes motility (PubMed:30174114). In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function (PubMed:30174114). May play a role in chromosome segregation (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Arl8a (NM_026823) Mouse Tagged ORF Clone
Your Rating
SKU Description Size
MC201644 Arl8a (untagged) - Mouse ADP-ribosylation factor-like 8A (Arl8a), (10ug) 10 ug
MG201740 Arl8a (tGFP-tagged) - Mouse ADP-ribosylation factor-like 8A (Arl8a) 10 ug
MR201740L3 Lenti ORF clone of Arl8a (Myc-DDK-tagged) - Mouse ADP-ribosylation factor-like 8A (Arl8a) 10 ug
MR201740L4 Lenti ORF clone of Arl8a (mGFP-tagged) - Mouse ADP-ribosylation factor-like 8A (Arl8a) 10 ug
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Products

  • cDNA Clones
  • Antibodies
  • Proteins
  • Vectors
  • RNAi
  • Gene Expression
  • Assay Kits
  • Tissues
  • Others

Product Support

  • Product FAQs
  • Product Manuals
  • SDS
  • Citations

Customer Support

  • Order Support
  • Technical Support
  • International Distributors
  • cDNA Clone Match
  • Product Review

Learning Resources

  • Video and Webinar
  • Brochures & Flyers
  • Protocols
  • Ebooks
  • Scientific Papers
  • Bioinformatics Tools

About Us

  • About Us
  • Press Releases
  • Conferences
  • Customer Testimonials
  • Careers
  • Legal Notices
  • Contact Us

Usted podría estar interesado también en los siguientes productos:



Referencia
Descripción
Cond.
Precio Sin IVA
A2585-10mg
 10mg