GSP1 Recombinant Protein
Referencia OPCA02056-100UG
embalaje : 100ug
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for GSP1 Recombinant Protein (Baker's yeast) (OPCA02056) (OPCA02056) |
---|
Predicted Species Reactivity | Saccharomyces cerevisiae |
---|---|
Product Format | Liquid or Lyophilized powder |
Host | Yeast |
Additional Information | Relevance: GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Essential for cell viability. By analogy with Ras, Ran may be activated when GTP is exchanged for bound GDP by RCC1 and inactivated when GTP is hydrolyzed by Ran upon activation by RanGAP1. |
Reconstitution and Storage | -20°C or -80°C |
Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL |
Protein Sequence | SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 2-219 aa |
Tag | N-terminal 6xHis-SUMO-tagged |
Reference | Cex1p is a novel Cytoplasmic domain component of the Saccharomyces cerevisiae nuclear tRNA export machinery.McGuire A.T., Mangroo D.EMBO J. 26:288-300(2007) |
---|---|
Gene Symbol | GSP1 |
Gene Full Name | Ran GTPase GSP1 |
Alias Symbols | Chromosome stability protein 17;CNR1;CST17;Genetic suppressor of PRP20-1;GTPase Ran homolog;Ran GTPase GSP1;YLR293C. |
NCBI Gene Id | 851000 |
Protein Name | GTP-binding nuclear protein GSP1/CNR1 |
Description of Target | GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Essential for cell viability. By analogy with Ras, Ran may be activated when GTP is exchanged for bound GDP by RCC1 and inactivated when GTP is hydrolyzed by Ran upon activation by RanGAP1. |
Uniprot ID | P32835 |
Protein Accession # | NP_013396.1 |
Nucleotide Accession # | NM_001182181.1 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 40.7 kDa |