- More Files
Western Blot (Cell lysate)
RPS7 monoclonal antibody (M03J), clone 3G4. Western Blot analysis of RPS7 expression in NIH/3T3.
Western Blot (Cell lysate)
RPS7 monoclonal antibody (M03J), clone 3G4. Western Blot analysis of RPS7 expression in PC-12.
Western Blot (Cell lysate)
RPS7 monoclonal antibody (M03J), clone 3G4. Western Blot analysis of RPS7 expression in Raw 264.7.
Western Blot (Cell lysate)
RPS7 monoclonal antibody (M03J), clone 3G4. Western Blot analysis of RPS7 expression in HeLa.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RPS7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RPS7 is 1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to RPS7 on HeLa cell . [antibody concentration 20 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant RPS7.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
RPS7 (NP_001002, 95 a.a. ~ 194 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQL
Host
Mouse
Reactivity
Human, Mouse, Rat
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Cell lysate)
RPS7 monoclonal antibody (M03J), clone 3G4. Western Blot analysis of RPS7 expression in NIH/3T3.Western Blot (Cell lysate)
RPS7 monoclonal antibody (M03J), clone 3G4. Western Blot analysis of RPS7 expression in PC-12.Western Blot (Cell lysate)
RPS7 monoclonal antibody (M03J), clone 3G4. Western Blot analysis of RPS7 expression in Raw 264.7.Western Blot (Cell lysate)
RPS7 monoclonal antibody (M03J), clone 3G4. Western Blot analysis of RPS7 expression in HeLa.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RPS7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RPS7 is 1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RPS7 on HeLa cell . [antibody concentration 20 ug/ml] - Gene Info — RPS7
Entrez GeneID
6201GeneBank Accession#
NM_001011Protein Accession#
NP_001002Gene Name
RPS7
Gene Alias
-
Gene Description
ribosomal protein S7
Omim ID
603658Gene Ontology
HyperlinkGene Summary
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq
Other Designations
40S ribosomal protein S7
- Interactomes
- Pathways