Anti-KLF5 (Kruppel-like Factor 5, Basic Transcription Element Binding Protein 2, BTE-binding Protein 2, BTEB2, Colon Krueppel-like Factor, CKLF, GC Box Binding Protein 2, Intestinal-enriched Krueppel-like Factor, IKLF, Transcription Factor BTEB2) Monoclonal Antibody
Referencia 128855-100ug
embalaje : 100ug
Marca : US Biological
128855 KLF5 (Kruppel-like Factor 5, Basic Transcription Element Binding Protein 2, BTE-binding Protein 2, BTEB2, Colon Krueppel-like Factor, CKLF, GC Box Binding Protein 2, Intestinal-enriched Krueppel-like Factor, IKLF, Transcription Factor BTEB2)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG2b,kGrade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
NM_001730, NP_001721Shipping Temp
Blue IceStorage Temp
-20°CKLF5 is a member of the Kruppel-like factor subfamily of zinc finger proteins. Since the protein localizes to the nucleus and binds the epidermal growth factor response element, the protein is thought to be a transcription factor.||Applications:|Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|RYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.