Crustacean Hyperglycemic Hormones, Recombinant, Carcinus maenas, aa67-138, His-Tag, Myc-Tag

Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction.||Source:|Recombinant protein corresponding to aa67-138 from Carcinus maenas Crustacean hyperglycemic hormones, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli.||Molecular Weight: |~16.0kD||Amino Acid Sequence:|QIYDTSCKGVYDRALFNDLEHVCDDCYNLYRTSYVASACRSNCYSNLVFRQCMDDLLMMDEFDQYARKVQMV||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.