Crustacean Hyperglycemic Hormones, Recombinant, Carcinus maenas, aa67-138, His-Tag, Myc-Tag

Referencia 584102-20ug

embalaje : 20ug

Marca : US Biological

Solicitar más información

Contact local distributor :


Teléfono : +1 850 650 7790


584102 Crustacean Hyperglycemic Hormones, Recombinant, Carcinus maenas, aa67-138, His-Tag, Myc-Tag

Clone Type
Polyclonal
Swiss Prot
P14944
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction.||Source:|Recombinant protein corresponding to aa67-138 from Carcinus maenas Crustacean hyperglycemic hormones, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli.||Molecular Weight: |~16.0kD||Amino Acid Sequence:|QIYDTSCKGVYDRALFNDLEHVCDDCYNLYRTSYVASACRSNCYSNLVFRQCMDDLLMMDEFDQYARKVQMV||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ≥85% (SDS-PAGE)|Concentration: As Reported |Form: Supplied as a liquid in Tris, pH 8.0, 6% trehalose, 50% glycerol||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a liquid in Tris, pH 8.0, 6% trehalose, 50% glycerol
Purity
≥85% (SDS-PAGE)