Quimigen Portugal > DHX35 Antibody - N-terminal region
DHX35 Antibody - N-terminal region
Referencia ARP36485_P050-25UL
embalaje : 25ul
Marca : Aviva Systems Biology
Solicitar más información
Por favor, inicie sesión para usar esta función.
Datasheets/Manuals | Printable datasheet for anti-DHX35 (ARP36485_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human DHX35 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Peptide Sequence | Synthetic peptide located within the following region: MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-DHX35 (ARP36485_P050) antibody is Catalog # AAP36485 (Previous Catalog # AAPP08542) |
Reference | Jurica,M.S., (2002) RNA 8 (4), 426-439 |
---|---|
Gene Symbol | DHX35 |
Gene Full Name | DEAH (Asp-Glu-Ala-His) box polypeptide 35 |
Alias Symbols | DDX35, C20orf15, KAIA0875 |
NCBI Gene Id | 60625 |
Protein Name | Probable ATP-dependent RNA helicase DHX35 |
Description of Target | DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of DHX35 which is a member of this family, has not been determined.DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of this gene product which is a member of this family, has not been determined. |
Uniprot ID | Q9H5Z1 |
Protein Accession # | NP_068750 |
Nucleotide Accession # | NM_021931 |
Protein Size (# AA) | 703 |
Molecular Weight | 79kDa |
Protein Interactions | UBC; Prpf8; |
Protein interactions
Name | # of Products |
---|---|
Prpf8 | 88 |
UBC | 7030 |
Biological pathways
Name | # of Products |
---|---|
Nuclear mRNA splicing, via spliceosome | 175 |
Biological process
Name | # of Products |
---|---|
Nuclear mRNA splicing, via spliceosome | 185 |
RNA splicing | 219 |
Cellular components
Name | # of Products |
---|---|
Catalytic step 2 spliceosome | 71 |
Protein function
Name | # of Products |
---|---|
ATP binding | 2814 |
ATP-dependent helicase activity | 109 |
Helicase activity | 219 |
Hydrolase activity | 1739 |
Nucleic acid binding | 617 |
Nucleotide binding | 3928 |
- DHX35 Antibody (OACA06404)Catalog #: OACA06404Conjugation: UnconjugatedApplication: ELISA, IHC, WBFormat: Liquid