Quimigen Portugal > HMGB1 Protein
HMGB1 Protein
Marca : Aviva Systems Biology
Solicitar más información
Por favor, inicie sesión para usar esta función.
Size:10UG
Bulk
Order
Order
Aviva's
Satisfaction
Guarantee
Satisfaction
Guarantee
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- : Antibody & Protein in US
- + /Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for HMGB1 Protein (OPPA01571) |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Lyophilized from a 0.2 um filtered concentrated solution in PBS (pH 7.4) |
Host | E. Coli |
Reconstitution and Storage | It is recommended to reconstitute the lyophilized HMGB1 in sterile 18M-omega-cm H2O not less than 100 ug/mL, which can then be further diluted to other aqueous solutions. Lyophilized HMGB1, although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HMGB1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long-term storage, it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze/thaw cycles. |
Purification | The HMGB-1 is purified by proprietary chromatographic techniques. |
Purity | Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Peptide Sequence | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDELEHHHHHH. |
Tag | 6xHis tag |
Gene Symbol | HMGB1 |
---|---|
Alias Symbols | HMG1, HMG3, HMG-1, SBP-1 |
NCBI Gene Id | 3146 |
Protein Name | High mobility group protein B1 |
Description of Target | HMG1 Human Recombinant fused with 6X His tag produced in E.coli is a single, non-glycosylated, polypeptide chain containing 223 amino acids. |
Uniprot ID | P09429 |
Protein Accession # | NP_002119.1 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 26 kDa |
Protein interactions
Name | # of Products |
---|---|
AES | 70 |
AGER | 20 |
AR | 434 |
ATOH1 | 8 |
C14orf1 | 153 |
CASP3 | 324 |
Ccdc15 | 38 |
CDK1 | 487 |
CREBBP | 802 |
CRMP1 | 164 |
CSNK1A1 | 104 |
CTCF | 81 |
DNM2 | 91 |
ERF | 13 |
FCP1 | 24 |
FOXA3 | 17 |
FOXC1 | 7 |
H3F3A | 189 |
HMGB2 | 25 |
HNRNPK | 104 |
HR | 23 |
HSPA8 | 331 |
LRIF1 | 281 |
ME | 21 |
MNT | 24 |
NCAN | 30 |
NEUROD6 | 7 |
PDIA3 | 61 |
POU5F1 | 224 |
PPP2R3A | 22 |
PRKDC | 226 |
RASSF4 | 8 |
RFX1 | 20 |
SIX5 | 8 |
SOX18 | 12 |
TAF1 | 88 |
TBP | 255 |
TFE3 | 45 |
TGIF1 | 46 |
TLE1 | 178 |
TLE2 | 49 |
TLR2 | 123 |
TLR4 | 158 |
TP73 | 137 |
UNC119 | 185 |
Biological process
Name | # of Products |
---|---|
Apoptotic process | 586 |
Base-excision repair, DNA ligation | 2 |
Cellular component disassembly involved in apoptosis | 43 |
Dendritic cell chemotaxis | 15 |
DNA fragmentation involved in apoptotic nuclear change | 33 |
DNA ligation involved in DNA repair | 8 |
DNA recombination | 76 |
DNA topological change | 6 |
Eye development | 24 |
Inflammatory response to antigenic stimulus | 8 |
Innate immune response | 300 |
Lung development | 105 |
Myeloid dendritic cell activation | 1 |
Negative regulation of apoptotic cell clearance | 1 |
Negative regulation of RNA polymerase II transcriptional preinitiation complex assembly | 3 |
Negative regulation of transcription from RNA polymerase II promoter | 574 |
Neuron projection development | 72 |
Positive chemotaxis | 33 |
Positive regulation of apoptotic process | 239 |
Positive regulation of catalytic activity | 55 |
Positive regulation of cysteine-type endopeptidase activity involved in apoptotic process | 36 |
Positive regulation of DNA binding | 27 |
Positive regulation of glycogen catabolic process | 4 |
Positive regulation of myeloid cell differentiation | 7 |
Positive regulation of transcription from RNA polymerase II promoter | 968 |
Regulation of transcription from RNA polymerase II promoter | 308 |
Response to glucocorticoid stimulus | 109 |
V(D)J recombination | 9 |
Cellular components
Name | # of Products |
---|---|
Cell surface | 369 |
Condensed chromosome | 21 |
Cytoplasm | 4549 |
Extracellular region | 1573 |
Extracellular space | 884 |
Neuron projection | 94 |
Nucleolus | 1179 |
Nucleoplasm | 775 |
Nucleus | 4914 |
Soluble fraction | 338 |
Transcriptional repressor complex | 43 |
Protein function
Name | # of Products |
---|---|
Calcium-dependent protein kinase regulator activity | 7 |
Chemoattractant activity | 120 |
Cytokine activity | 1104 |
Damaged DNA binding | 135 |
DNA binding | 3958 |
DNA binding, bending | 220 |
Double-stranded DNA binding | 533 |
Protein binding | 12191 |
Protein kinase activator activity | 51 |
RAGE receptor binding | 22 |
Repressing transcription factor binding | 106 |
Sequence-specific DNA binding transcription factor activity | 2776 |
Single-stranded DNA binding | 136 |
Transcription factor binding | 934 |
- HMGB1 Antibody - N-terminal region (ARP38109_P050)Catalog #: ARP38109_P050Species Tested: Human, RatApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- HMGB1 Antibody (Acetyl-Lys12) (OASG03545)Catalog #: OASG03545Application: ELISA, IF, IHC, IPFormat: Liquid. PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.Size: 100 uL
- HMGB1 ELISA Kit (Mouse) : 96 Wells (OKEH00424)Catalog #: OKEH00424Kit Range: 0.156 - 10ng/mLSensitivity: 0.082 ng/mLSize: 96 Wells
- HMGB1 ELISA Kit (Chicken) (OKEH03961)Catalog #: OKEH03961Application: ELISA-SandwichKit Range: 0.156-10ng/mLSensitivity: 0.062 ng/mLSize: 96W
- HMGB1 ELISA Kit (Mouse) (OKCD04072)Catalog #: OKCD04072Application: ELISA-SandwichKit Range: 46.88-3,000pg/mLSensitivity: 18.29 pg/mLSize: 96WELLS