Holo-[acyl-carrier-protein] Synthase, Recombinant, Acholeplasma laidlawii, aa1-118, His-Tag, Myc-Tag

Referencia 584877-100ug

embalaje : 100ug

Marca : US Biological

Contact local distributor :


Teléfono : +1 850 650 7790


584877 Rabbit Anti-Holo-[acyl-carrier-protein] Synthase, Recombinant, Acholeplasma laidlawii, aa1-118, His-Tag, Myc-Tag

Clone Type
Polyclonal
Swiss Prot
A9NHV3
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.||Source:|Recombinant protein corresponding to aa1-118 from Acholeplasma laidlawii Holo-[acyl-carrier-protein] synthase, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli.||Molecular Weight: |~20.9kD||Amino Acid Sequence:|MIHAIGTDLVELERIKSIGIDRFKDKILNEDEKNEYAKINHENRKLTYLAGRFAVKESLFKCFKAGDKTANYKDFSVLNDSVGAPYVVSKHTSDFVVHITISHTNLYAIAFVVLETKV||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ≥85% (SDS-PAGE)|Concentration: As Reported |Form: Supplied as a liquid in Tris, pH 8.0, 6% trehalose, 50% glycerol||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a liquid in Tris, pH 8.0, 6% trehalose, 50% glycerol
Purity
≥85% (SDS-PAGE)