Reactivos e instrumentos para inmunología, biología celular y biología molecular.
 
> Luteinizing Hormone beta (LHB) (NM_000894) Human Recombinant Protein

Luteinizing Hormone beta (LHB) (NM_000894) Human Recombinant Protein

Imprimir Imprimir
Por favor conéctese

Referencia TP316028L

embalaje : 1mg

Solicitar más información

Contact local distributor :


Teléfono :

Luteinizing Hormone beta (LHB) (NM_000894) Human Recombinant Protein

main product photo
SKU
TP316028L
Recombinant protein of human luteinizing hormone beta polypeptide (LHB), 1 mg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216028 representing NM_000894
Red=Cloning site Green=Tags(s)

MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLP
PLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLF
L

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 13.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000885
Locus ID 3972
UniProt ID P01229
Cytogenetics 19q13.33
RefSeq Size 523
RefSeq ORF 423
Synonyms CGB4; HH23; LSH-B; LSH-beta
Summary This gene is a member of the glycoprotein hormone beta chain family and encodes the beta subunit of luteinizing hormone (LH). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. LH is expressed in the pituitary gland and promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The genes for the beta chains of chorionic gonadotropin and for luteinizing hormone are contiguous on chromosome 19q13.3. Mutations in this gene are associated with hypogonadism which is characterized by infertility and pseudohermaphroditism. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways GnRH signaling pathway, Neuroactive ligand-receptor interaction
FAQs
  • Protein FAQs
SDS
Recombinant Protein Resources

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.