MFN2 Antibody - middle region
Referencia ARP89255_P050-25UL
embalaje : 25ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
MFN2 Antibody - middle region (ARP89255_P050)
| Datasheets/Manuals | Printable datasheet for anti-YBX3 (ARP89255_P050) antibody |
|---|
| Publications | Increased ROS-Dependent Fission of Mitochondria Causes Abnormal Morphology of the Cell Powerhouses in a Murine Model of Amyotrophic Lateral Sclerosis. Oxid Med Cell Longev. 2021, 6924251 (2021). 34691359 |
|---|---|
| Tested Species Reactivity | Mouse |
| Predicted Species Reactivity | Mouse |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse MFN2 |
| Purification | Affinity purified |
| Peptide Sequence | Synthetic peptide located within the following region: FHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELG |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-MFN2 (ARP89255_P050) antibody is Catalog # AAP89255 |
| Gene Symbol | MFN2 |
|---|---|
| Gene Full Name | mitofusin 2 |
| Alias Symbols | Fz, Fzo, D630023P19Rik |
| NCBI Gene Id | 170731 |
| Protein Name | mitofusin-2 |
| Description of Target | Mitochondrial outer membrane GTPase that mediates mitochondrial clustering and fusion. Mitochondria are highly dynamic organelles, and their morphology is determined by the equilibrium between mitochondrial fusion and fission events. Overexpression induces the formation of mitochondrial networks. Membrane clustering requires GTPase activity and may involve a major rearrangement of the coiled coil domains (By similarity). Plays a central role in mitochondrial metabolism and may be associated with obesity and/or apoptosis processes. Plays an important role in the regulation of vascular smooth muscle cell proliferation (By similarity). Involved in the clearance of damaged mitochondria via selective autophagy (mitophagy). Is required for PRKN recruitment to dysfunctional mitochondria. Involved in the control of unfolded protein response (UPR) upon ER stress including activation of apoptosis and autophagy during ER stress. Acts as an upstream regulator of EIF2AK3 and suppresses EIF2AK3 activation under basal conditions. |
| Uniprot ID | Q80U63-2 |
| Protein Accession # | NP_001272849.1 |
| Nucleotide Accession # | NM_001285920.1 |
| Protein Size (# AA) | 605 |
| Molecular Weight | 69 kDa |