MFN2 Antibody - N-terminal region

Referencia ARP42419_P050-25UL

embalaje : 25ul

Marca : Aviva Systems Biology

Contact local distributor :


Teléfono : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-MFN2 (ARP42419_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MFN2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 82%
Peptide SequenceSynthetic peptide located within the following region: STVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKT
Concentration0.5 mg/ml
Blocking PeptideFor anti-MFN2 (ARP42419_P050) antibody is Catalog # AAP42419 (Previous Catalog # AAPP24764)
ReferenceChung,K.W., (2008) Neurology 70 (21), 2010-2011
Gene SymbolMFN2
Gene Full NameMitofusin 2
Alias SymbolsHSG, MARF, CMT2A, CPRP1, CMT2A2, HMSN6A, CMT2A2A, CMT2A2B
NCBI Gene Id9927
Protein NameMitofusin-2
Description of TargetMFN2 is a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. It is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke.This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified.
Uniprot IDO95140
Protein Accession #NP_055689
Nucleotide Accession #NM_014874
Protein Size (# AA)757
Molecular Weight86kDa
Protein InteractionsUBC; MARCH5; PARK2; UBE2N; MFN2; TER94; MAVS; vpr; HUWE1; MAPK9;
  1. What is the species homology for "MFN2 Antibody - N-terminal region (ARP42419_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "MFN2 Antibody - N-terminal region (ARP42419_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MFN2 Antibody - N-terminal region (ARP42419_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MFN2 Antibody - N-terminal region (ARP42419_P050)"?

    This target may also be called "HSG, MARF, CMT2A, CPRP1, CMT2A2, HMSN6A, CMT2A2A, CMT2A2B" in publications.

  5. What is the shipping cost for "MFN2 Antibody - N-terminal region (ARP42419_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "MFN2 Antibody - N-terminal region (ARP42419_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MFN2 Antibody - N-terminal region (ARP42419_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "86kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MFN2 Antibody - N-terminal region (ARP42419_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MFN2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MFN2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MFN2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MFN2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MFN2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MFN2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Usted podría estar interesado también en los siguientes productos:



Referencia
Descripción
Cond.
Precio Sin IVA
AP8840c-ev
 80ul 
ARP89255_P050-25UL
 25ul 
ARP57702_P050-25UL
 25ul