MRCA Recombinant Protein (Neisseria meningitidis serogroup B)
Referencia OPCA05126-1MG
embalaje : 1mg
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
| Datasheets/Manuals | Printable datasheet for MRCA Recombinant Protein (Neisseria meningitidis serogroup B) (OPCA05126) (OPCA05126) |
|---|
| Predicted Species Reactivity | Neisseria meningitidis |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Additional Information | Species Specificity Detail: Neisseria meningitidis serogroup B (strain MC58) |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | Tris-base, 50% glycerol |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | KAPSAYNPIVNPERAKLRQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQSALYVAEMVRQELYEKYGEDAYTQGFKVYTTVRADHQKVATEALRKALRNFDRGSSYRGAENYIDLSKSEDVEETVSQYLSGLYTVDKMVPAVVLDVTKKKNVVIQLPGGRRVTLDRRALGFAARAVNNEKMGEDRIRRGAVIRVKNNGGRW |
| Protein Sequence | KAPSAYNPIVNPERAKLRQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQSALYVAEMVRQELYEKYGEDAYTQGFKVYTTVRADHQKVATEALRKALRNFDRGSSYRGAENYIDLSKSEDVEETVSQYLSGLYTVDKMVPAVVLDVTKKKNVVIQLPGGRRVTLDRRALGFAARAVNNEKMGEDRIRRGAVIRVKNNGGRW |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 206-413 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Complete genome sequence of Neisseria meningitidis serogroup B strain MC58. Tettelin H., Saunders N.J., Heidelberg J.F., Jeffries A.C., Nelson K.E., Eisen J.A., Ketchum K.A., Hood D.W., Peden J.F., Dodson R.J., Nelson W.C., Gwinn M.L., DeBoy R.T., Peterson J.D., Hickey E.K., Haft D.H., Salzberg S.L., White O. Venter J.C. Science 287:1809-1815(2000) |
|---|---|
| Gene Symbol | NMB_RS09430 |
| Gene Full Name | penicillin-binding protein 1A |
| Alias Symbols | NMB_RS09430;NMB1807;penicillin-binding protein 1A. |
| NCBI Gene Id | 903291 |
| Protein Name | Penicillin-binding protein 1A |
| Description of Target | Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits). |
| Uniprot ID | P0A0Z6 |
| Protein Accession # | NP_274804 |
| Nucleotide Accession # | NC_003112 |
| Protein Size (# AA) | Recombinant |
| Molecular Weight | 40 kDa |