SLC6A16 (NTT5, Orphan Sodium-and Chloride-dependent Neurotransmitter Transporter NTT5, Solute Carrier Family 6 Member 16) (HRP)
Referencia 133506-HRP-100ul
embalaje : 100ul
Marca : US Biological
133506-HRP SLC6A16 (NTT5, Orphan Sodium-and Chloride-dependent Neurotransmitter Transporter NTT5, Solute Carrier Family 6 Member 16) (HRP)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG1,kGrade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
NM_014037Shipping Temp
Blue IceStorage Temp
-20°CSLC6A16 shows structural characteristics of an Na(+)- and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.||Applications:|Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|RCCERNAEILLKLINLGKLPPDAKPPVNLLYNPTSIYNAWLSGLPQHIKSMVLREVTECNIETQFLKASEGPKFAFLSFVEAMSFLP*||Storage and Stability:|Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.||Note: Applications are based on unconjugated antibody.