Small EDRK rich factor 1 (SERF1A) (NM_022968) Human Recombinant Protein

Referencia TP324986

embalaje : 20ug

Contact local distributor :


Teléfono :

Small EDRK rich factor 1 (SERF1A) (NM_022968) Human Recombinant Protein

SKU
TP324986
Recombinant protein of human small EDRK-rich factor 1A (telomeric) (SERF1A), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

In Stock*
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224986 representing NM_022968
Red=Cloning site Green=Tags(s)

MARGNQRELARQKNMKKTQEISKGKRKEDSLTASQRKQRDSEIMQEKQKAANEKKSMQTREK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 7.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_075257
Locus ID 8293
UniProt ID O75920
Cytogenetics 5q13.2
RefSeq ORF 186
Synonyms 4F5; FAM2A; H4F5; SERF1; SMAM1
Summary This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. The duplication region includes both a telomeric and a centromeric copy of this gene. Deletions of this gene, the telomeric copy, often accompany deletions of the neighboring SMN1 gene in spinal muscular atrophy (SMA) patients, and so it is thought that this gene may be a modifier of the SMA phenotype. The function of this protein is not known; however, it bears low-level homology with the RNA-binding domain of matrin-cyclophilin, a protein which colocalizes with small nuclear ribonucleoproteins (snRNPs) and the SMN1 gene product. Alternatively spliced transcripts have been documented but it is unclear whether alternative splicing occurs for both the centromeric and telomeric copies of the gene. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:Small EDRK rich factor 1 (SERF1A) (NM_022968) Human Recombinant Protein
Your Rating
SKU Description Size
PH324986 SERF1A MS Standard C13 and N15-labeled recombinant protein (NP_075257) 10 ug
LC411852 SERF1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LC429713 SERF1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY411852 Transient overexpression lysate of small EDRK-rich factor 1A (telomeric) (SERF1A), transcript variant 1 100 ug
LY429713 Transient overexpression lysate of small EDRK-rich factor 1A (telomeric) (SERF1A), transcript variant 2 100 ug
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Products

  • cDNA Clones
  • Antibodies
  • Proteins
  • Vectors
  • RNAi
  • Gene Expression
  • Assay Kits
  • Tissues
  • Others

Product Support

  • Product FAQs
  • Product Manuals
  • SDS
  • Citations

Customer Support

  • Order Support
  • Technical Support
  • International Distributors
  • cDNA Clone Match
  • Product Review

Learning Resources

  • Video and Webinar
  • Brochures & Flyers
  • Protocols
  • Ebooks
  • Scientific Papers
  • Bioinformatics Tools

About Us

  • About Us
  • Press Releases
  • Conferences
  • Customer Testimonials
  • Careers
  • Legal Notices
  • Contact Us