TBX19 antibody - N-terminal region

Referencia ARP32363_T100

embalaje : 100ul

Marca : Aviva Systems Biology

Solicitar más información

Contact local distributor :


Teléfono : +1 850 650 7790

TBX19 Antibody - N-terminal region (ARP32363_T100)

Datasheets/ManualsPrintable datasheet for anti-TBX19 (ARP32363_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TBX19
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: KPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTN
Concentration1.0 mg/ml
Blocking PeptideFor anti-TBX19 (ARP32363_T100) antibody is Catalog # AAP32363 (Previous Catalog # AAPP03352)
ReferenceMaira,M.,et al.,(2003) J.Biol.Chem.278(47),46523-46532
Gene SymbolTBX19
Gene Full NameT-box 19
Alias SymbolsTPIT, TBS19, dJ747L4.1
NCBI Gene Id9095
Protein NameT-box transcription factor TBX19
Description of TargetTBX19 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX19 is the human ortholog of mouse Tbx19/Tpit gene. Studies in mouse show that Tpit protein is present only in the two pituitary pro-opiomelanocortin (POMC)-expressing lineages, the corticotrophs and melanotrophs. Mutations in the human ortholog were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage.
Uniprot IDO60806
Protein Accession #NP_005140
Nucleotide Accession #NM_005149
Protein Size (# AA)448
Molecular Weight48kDa
Protein InteractionsNR5A1;