TBX19 antibody - N-terminal region
Referencia ARP32363_T100
embalaje : 100ul
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-TBX19 (ARP32363_T100) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TBX19 |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: KPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTN |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-TBX19 (ARP32363_T100) antibody is Catalog # AAP32363 (Previous Catalog # AAPP03352) |
Reference | Maira,M.,et al.,(2003) J.Biol.Chem.278(47),46523-46532 |
---|---|
Gene Symbol | TBX19 |
Gene Full Name | T-box 19 |
Alias Symbols | TPIT, TBS19, dJ747L4.1 |
NCBI Gene Id | 9095 |
Protein Name | T-box transcription factor TBX19 |
Description of Target | TBX19 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX19 is the human ortholog of mouse Tbx19/Tpit gene. Studies in mouse show that Tpit protein is present only in the two pituitary pro-opiomelanocortin (POMC)-expressing lineages, the corticotrophs and melanotrophs. Mutations in the human ortholog were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage. |
Uniprot ID | O60806 |
Protein Accession # | NP_005140 |
Nucleotide Accession # | NM_005149 |
Protein Size (# AA) | 448 |
Molecular Weight | 48kDa |
Protein Interactions | NR5A1; |