acpS Protein, Acholeplasma laidlawii, Recombinant (His & Myc)
Referencia TMPH-00017-1mg
embalaje : 1mg
Marca : TargetMol
acpS Protein, Acholeplasma laidlawii, Recombinant (His & Myc)
Resource Download
acpS Protein, Acholeplasma laidlawii, Recombinant (His & Myc)
Catalog No. TMPH-00017
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. acpS Protein, Acholeplasma laidlawii, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.9 kDa and the accession number is A9NHV3.
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose. Pack Size | |
---|---|
20 μg | |
100 μg | |
1 mg |
Biological Description
Biological Information | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. acpS Protein, Acholeplasma laidlawii, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.9 kDa and the accession number is A9NHV3. |
Species | Acholeplasma laidlawii |
Expression System | E. coli |
Tag | N-10xHis, C-Myc |
Accession Number | A9NHV3 |
Synonyms | Holo-ACP synthase,Holo-[acyl-carrier-protein] synthase,acpS,4'-phosphopantetheinyl transferase AcpS |
Amino Acid | MIHAIGTDLVELERIKSIGIDRFKDKILNEDEKNEYAKINHENRKLTYLAGRFAVKESLFKCFKAGDKTANYKDFSVLNDSVGAPYVVSKHTSDFVVHITISHTNLYAIAFVVLETKV |
Construction | 1-118 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 20.9 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.