Quimigen Portugal > CDKN1A Antibody - N-terminal region
CDKN1A Antibody - N-terminal region
Marca : Aviva Systems Biology
Solicitar más información
Por favor, inicie sesión para usar esta función.
Datasheets/Manuals | Printable datasheet for anti-CDKN1A (ARP30198_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDKN1A |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 92%; Guinea Pig: 92%; Horse: 83%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 92%; Rat: 100%; Sheep: 100%; |
Peptide Sequence | Synthetic peptide located within the following region: KACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAW |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-CDKN1A (ARP30198_P050) antibody is Catalog # AAP30198 |
Gene Symbol | CDKN1A |
---|---|
Gene Full Name | cyclin-dependent kinase inhibitor 1A (p21, Cip1) |
Alias Symbols | P21, CIP1, SDI1, WAF1, CAP20, CDKN1, MDA-6, p21CIP1 |
NCBI Gene Id | 1026 |
Protein Name | Cyclin-dependent kinase inhibitor 1 |
Description of Target | This gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-CDK2 or -CDK4 complexes, and thus functions as a regulator of cell cycle progression at G1. The expression of this gene is tightly controlled by the tumor suppressor protein p53, through which this protein mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. This protein can interact with proliferating cell nuclear antigen (PCNA), a DNA polymerase accessory factor, and plays a regulatory role in S phase DNA replication and DNA damage repair. This protein was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of CDK2, and may be instrumental in the execution of apoptosis following caspase activation. Multiple alternatively spliced variants have been found for this gene. |
Uniprot ID | Q6FI05 |
Protein Accession # | NP_510867 |
Nucleotide Accession # | NM_078467 |
Protein Size (# AA) | 164 |
Molecular Weight | 18kDa |
Protein Interactions | CCND1; PCNA; KRT31; TRIM54; TEX11; IKZF3; UBC; TRAF1; TCF4; SKP2; CCND3; CCND2; PHKG2; PHKA1; NCL; HSPA9; HSPA8; HSPA5; HSPA2; HSPA1A; HNRNPA2B1; CDK2; CDK5; CDK4; CDK3; CDC20; CCNE1; CCNB1; CCNA2; CAMK2D; ABR; GIGYF2; ANKRD17; UBR4; SNRNP200; FBXO21; PUF |
Protein interactions
Name | # of Products |
---|---|
A1BG | 11 |
A2M | 261 |
ACTB | 306 |
ALAS1 | 16 |
ANGPT2 | 8 |
APLP1 | 86 |
ATP5B | 75 |
ATP6V1A | 9 |
BAG6 | 225 |
CCNB1 | 173 |
CDK1 | 487 |
CENPB | 34 |
CHGB | 46 |
CLEC3B | 68 |
COL4A5 | 57 |
CPNE2 | 22 |
CPNE6 | 25 |
CTSB | 172 |
DYNC1I1 | 44 |
EEF1A1 | 227 |
FKBPL | 14 |
HSP90AA1 | 525 |
MLL4 | 51 |
NFE2L2 | 86 |
PCNA | 402 |
PDE4DIP | 33 |
S | 41 |
SETDB1 | 252 |
SUMO3 | 154 |
TLE1 | 178 |
TMSB4X | 36 |
TP53 | 1010 |
TUBA1A | 138 |
TUBB2B | 16 |
TUBB3 | 74 |
UBE2D1 | 194 |
UNC119 | 185 |
USP4 | 80 |
VIM | 324 |
ZBTB16 | 145 |
ZNF135 | 13 |
ZNF431 | 9 |
Biological pathways
Name | # of Products |
---|---|
Cell cycle arrest | 360 |
Cellular response to extracellular stimulus | 7 |
Cellular response to ionizing radiation | 33 |
DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest | 135 |
G1 phase of mitotic cell cycle | 94 |
G1/S transition of mitotic cell cycle | 322 |
G2/M transition of mitotic cell cycle | 206 |
Induction of apoptosis by intracellular signals | 137 |
Negative regulation of cell growth | 201 |
Negative regulation of cell proliferation | 554 |
Positive regulation of fibroblast proliferation | 119 |
Positive regulation of reactive oxygen species metabolic process | 55 |
Ras protein signal transduction | 211 |
S phase of mitotic cell cycle | 263 |
Stress-induced premature senescence | 3 |
Biological process
Name | # of Products |
---|---|
Cell cycle | 355 |
Cell cycle arrest | 142 |
Cell cycle checkpoint | 112 |
Cellular response to extracellular stimulus | 17 |
Cellular response to ionizing radiation | 19 |
Cellular senescence | 11 |
DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest | 61 |
G1 phase of mitotic cell cycle | 39 |
G1/S transition of mitotic cell cycle | 139 |
G2/M transition of mitotic cell cycle | 93 |
Induction of apoptosis by intracellular signals | 47 |
Mitotic cell cycle | 251 |
Negative regulation of apoptotic process | 356 |
Negative regulation of cell growth | 119 |
Negative regulation of cell proliferation | 375 |
Negative regulation of cyclin-dependent protein kinase activity | 19 |
Negative regulation of gene expression | 70 |
Negative regulation of phosphorylation | 25 |
Organ regeneration | 59 |
Phosphorylation | 101 |
Positive regulation of anti-apoptosis | 53 |
Positive regulation of B cell proliferation | 66 |
Positive regulation of fibroblast proliferation | 47 |
Positive regulation of programmed cell death | 9 |
Positive regulation of reactive oxygen species metabolic process | 31 |
Ras protein signal transduction | 64 |
Regulation of cyclin-dependent protein kinase activity | 44 |
Regulation of DNA biosynthetic process | 2 |
Regulation of mitotic cell cycle | 26 |
Regulation of protein import into nucleus, translocation | 5 |
Response to arsenic-containing substance | 10 |
Response to corticosterone stimulus | 27 |
Response to DNA damage stimulus | 144 |
Response to drug | 323 |
Response to hyperoxia | 20 |
Response to organic cyclic compound | 128 |
Response to organic nitrogen | 41 |
Response to toxin | 75 |
Response to UV | 43 |
S phase of mitotic cell cycle | 95 |
Stress-induced premature senescence | 4 |
Cellular components
Name | # of Products |
---|---|
Cyclin-dependent protein kinase holoenzyme complex | 11 |
Cytoplasm | 4549 |
Cytosol | 1868 |
Nucleoplasm | 775 |
Nucleus | 4914 |
PCNA-p21 complex | 2 |
Protein function
Name | # of Products |
---|---|
Cyclin binding | 46 |
Cyclin-dependent protein kinase activating kinase activity | 3 |
Cyclin-dependent protein kinase activity | 102 |
Cyclin-dependent protein kinase inhibitor activity | 48 |
Kinase activity | 353 |
Metal ion binding | 5514 |
Protein binding | 12191 |
Protein kinase inhibitor activity | 49 |
- CDKN1A Antibody (OASG05487)Catalog #: OASG05487Application: ELISA, IF, IHC, WBFormat: Liquid. PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.Size: 100 uL
- CDKN1A Antibody (Phospho-Thr145) (OASG05486)Catalog #: OASG05486Application: ELISA, IF, IHC, WBFormat: Liquid. PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.Size: 100 uL