Recombinant Human Interleukin-1 beta/IL-1 beta

Referencia 32-8285-10

embalaje : 10ug

Marca : Abeomics

Solicitar más información

Contact local distributor :


Teléfono : +1 850 650 7790

Recombinant Human Interleukin-1 beta/IL-1 beta



Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Gene : IL1B
Gene ID : 3553
Uniprot ID : P01584
Source: E. coli.
MW :17.5kD.
Recombinant Human Interleukin-1 beta is produced by our E.coli expression system and the target gene encoding Ala117-Ser269 is expressed. IL1B belongs to the IL-1 family. Interleukin 1 (IL-1) is a family of polypeptide cytokines consisting of two agonists, IL-1 alpha (IL-1F1) and IL-1 beta (IL-1F2) encoded by two distinct genes and perform identical biological functions. IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response. It is identified as endogenous pyrogens, and is reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Cytoplasm, Lysosome, Secreted, Secreted
Post transnational modification: Activation of the IL1B precursor involves a CASP1-catalyzed proteolytic cleavage. Processing and secretion are temporarily associated.
Tissue Specificity: Expressed in activated monocytes/macrophages (at protein level).
BioGrid: 109769. 15 interactions.
There are currently no product reviews