acpS Protein, Acholeplasma laidlawii, Recombinant (His & Myc)

Referência TMPH-00017-1mg

Tamanho : 1mg

Marca : TargetMol

Contactar o distribuidor local :


Telefone : +1 850 650 7790

acpS Protein, Acholeplasma laidlawii, Recombinant (His & Myc)

acpS Protein, Acholeplasma laidlawii, Recombinant (His & Myc)
Resource Download

acpS Protein, Acholeplasma laidlawii, Recombinant (His & Myc)

Catalog No. TMPH-00017
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. acpS Protein, Acholeplasma laidlawii, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.9 kDa and the accession number is A9NHV3.
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Pack Size
20 μg
100 μg
1 mg

Biological Description

Biological Information
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. acpS Protein, Acholeplasma laidlawii, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.9 kDa and the accession number is A9NHV3.
Species
Acholeplasma laidlawii
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberA9NHV3
Synonyms
Holo-ACP synthase,Holo-[acyl-carrier-protein] synthase,acpS,4'-phosphopantetheinyl transferase AcpS
Amino Acid
MIHAIGTDLVELERIKSIGIDRFKDKILNEDEKNEYAKINHENRKLTYLAGRFAVKESLFKCFKAGDKTANYKDFSVLNDSVGAPYVVSKHTSDFVVHITISHTNLYAIAFVVLETKV
Construction
1-118 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight20.9 kDa (predicted)
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.