PTPN5 Rabbit Polyclonal Antibody
Referência TA335980
Tamanho : 100ul
Product Data | |
Application | WB |
---|---|
Application | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PTPN5 Antibody: synthetic peptide directed towards the middle region of human PTPN5. Synthetic peptide located within the following region: VPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNE |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 60 kDa |
Gene Name | protein tyrosine phosphatase, non-receptor type 5 |
Database Link | |
Background | The specific functin of this protein remains unknown. |
Synonyms | PTPSTEP; STEP |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data |
Write Your Own Review
Product Manuals |
FAQs |
|
SDS |
Antibody Resources |
|
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.