Recombinant Human C-X-C Motif Chemokine 5/CXCL5

Referência 32-8133-10

Tamanho : 10ug

Marca : Abeomics

Solicitar mais informações

Contactar o distribuidor local :


Telefone : +1 850 650 7790


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB, pH 6.0.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : MLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Gene : CXCL5
Gene ID : 6374
Uniprot ID : P42830
Source: E. coli.
MW :7.95kD.
Recombinant Human C-X-C Motif Chemokine 5 is produced by our E.coli expression system and the target gene encoding Leu44-Asn114 is expressed. C-X-C Motif Chemokine 5 (CXCL5) is a member of the Intercrine Alpha (Chemokine CXC) family. CXCL5 can be cleaved into the following two chains, ENA-78 (8-78) and ENA-78 (9-78). In vitro, ENA-78(8-78) and ENA-78 (9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. CXCL5 is a secreted protein and exercises the functions primarily through interactions with CXCR2. The upregulation of CXCL5 contributes to increased vascularization, tumor grown, and metastasis in many cancers.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
Post transnational modification: N-terminal processed forms ENA-78(8-78) and ENA-78(9-78) are produced by proteolytic cleavage after secretion from peripheral blood monocytes.
BioGrid: 112276. 2 interactions.
There are currently no product reviews

Products

  • Cell Lines
  • Recombinant Proteins
  • Kits and Reagents
  • sdMAB ™

Services