SLC6A16 (NTT5, Orphan Sodium-and Chloride-dependent Neurotransmitter Transporter NTT5, Solute Carrier Family 6 Member 16) (FITC)
Referência 133506-FITC-100ul
Tamanho : 100ul
Marca : US Biological
133506-FITC SLC6A16 (NTT5, Orphan Sodium-and Chloride-dependent Neurotransmitter Transporter NTT5, Solute Carrier Family 6 Member 16) (FITC)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG1,kGrade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
NM_014037Shipping Temp
Blue IceStorage Temp
-20°CSLC6A16 shows structural characteristics of an Na(+)- and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.||Applications:|Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|RCCERNAEILLKLINLGKLPPDAKPPVNLLYNPTSIYNAWLSGLPQHIKSMVLREVTECNIETQFLKASEGPKFAFLSFVEAMSFLP*||Storage and Stability:|Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.||Note: Applications are based on unconjugated antibody.