Tpit (TBX19) Rabbit Polyclonal Antibody

Referência TA330269

Tamanho : 100ul

Contactar o distribuidor local :


Telefone :

Tpit (TBX19) Rabbit Polyclonal Antibody

Specifications
Product Data
Application WB
Application WB
Reactivity Human
Antibody Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TBX19 antibody: synthetic peptide directed towards the middle region of human TBX19. Synthetic peptide located within the following region: IKYNPFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCT
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 48 kDa
Gene Name T-box 19
Database Link
Background TBX19 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx19/Tpit gene. Studies in mouse show that Tpit protein is present only in the two pituitary pro-opiomelanocortin (POMC)-expressing lineages, the corticotrophs and melanotrophs. Mutations in the human ortholog were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage.This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage. ACTH deficiency is characterized by adrenal insufficiency symptoms such as weight loss, lack of appetite (anorexia), weakness, nausea, vomiting, and low blood pressure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms dJ747L4.1; TBS19; TPIT
Note Immunogen sequence homology: Human: 100%; Pig: 93%; Mouse: 93%; Rabbit: 93%; Horse: 85%; Dog: 79%; Bovine: 79%; Guinea pig: 79%; Rat: 77%
Reference Data
Write Your Own Review
You're reviewing:Tpit (TBX19) Rabbit Polyclonal Antibody
Your Rating
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Products

  • cDNA Clones
  • Antibodies
  • Proteins
  • Vectors
  • RNAi
  • Gene Expression
  • Assay Kits
  • Tissues
  • Others

Product Support

  • Product FAQs
  • Product Manuals
  • SDS
  • Citations

Customer Support

  • Order Support
  • Technical Support
  • International Distributors
  • cDNA Clone Match
  • Product Review

Learning Resources

  • Video and Webinar
  • Brochures & Flyers
  • Protocols
  • Ebooks
  • Scientific Papers
  • Bioinformatics Tools

About Us

  • About Us
  • Press Releases
  • Conferences
  • Customer Testimonials
  • Careers
  • Legal Notices
  • Contact Us

Você também pode estar interessado nos seguintes produtos:



Referência
Descrição
Cond.
Price Bef. VAT
OAAF08287-100UL
 100ul